Basic Information | |
---|---|
Taxon OID | 3300028125 Open in IMG/M |
Scaffold ID | Ga0256368_1009688 Open in IMG/M |
Source Dataset Name | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1607 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine → Extreme Environments Viral Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Alaska | |||||||
Coordinates | Lat. (o) | 71.3731 | Long. (o) | -156.5049 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049655 | Metagenome / Metatranscriptome | 146 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256368_10096883 | F049655 | N/A | MKNSNYYFNEETIEYFHSRSYEINDAEELREEMFNFVNVDYEVGDNESVEKAVDSLIEQVINYV |
⦗Top⦘ |