Scaffold Ga0268354_1007096

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0268354_1007096

Scaffold Ga0268354_1007096

Overview

Basic Information
Taxon OID	3300028148 Open in IMG/M
Scaffold ID	Ga0268354_1007096 Open in IMG/M
Source Dataset Name	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_18SEP2017_LD1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	892
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	42.39	Long. (^o)	-85.37	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018870	Metagenome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268354_10070962	F018870	N/A	MQRNRAKPPRNIVLGLKKWIGQDRCEKTRRNFESTKCCILCTPKPDLTTCTSRQRNHAEPPRNLVLGLKKWMGHVRCEKTRRNFGSTKWCILCTPKPDLTTCTTRQRNRAKPPRNLVLGLKKWIWHVRCEKTRCNFGSTKWCIVCTPNPDLTTGTSRQRNHAKPPRNLVLD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.