Basic Information | |
---|---|
Taxon OID | 3300028189 Open in IMG/M |
Scaffold ID | Ga0257127_1106209 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_135m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 817 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: British Columbia | |||||||
Coordinates | Lat. (o) | 48.6 | Long. (o) | -123.5 | Alt. (m) | Depth (m) | 135 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058644 | Metagenome | 134 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0257127_11062091 | F058644 | N/A | MKIVTDIISPAVKADVNFAPNLHDIKLEAKKVEKTKPIIGKKTAYIIKIKAVIKISIIFPNLGQIGFISGLKIRNKDEVIKKNETMY |
⦗Top⦘ |