NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257107_1047358

Scaffold Ga0257107_1047358


Overview

Basic Information
Taxon OID3300028192 Open in IMG/M
Scaffold IDGa0257107_1047358 Open in IMG/M
Source Dataset NameMarine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1331
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: Northeast Subartic Pacific Ocean
CoordinatesLat. (o)50.0Long. (o)-145.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027866Metagenome / Metatranscriptome193Y
F066839Metagenome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0257107_10473581F066839AGGAMIRVKIQYRDMTEKQCKKFWLDYPEEDCKGRKYTDPDILDAVWEDWNNGSGRECTLFKKLEVRSMMVGDYVSILRPTVASVWHECLAIGWRINVPWEEVLGNAPKQDFSDISPEDVSKALVNKLNQDVWWERMIKNNDIVWEDHEALSRN
Ga0257107_10473582F027866N/AMKQYKTYNAKNAVKAAQVTNHIKAQKKLGISHSVAKAEAYRIYNIKAAKPILLRYFVKVG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.