NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257121_1263518

Scaffold Ga0257121_1263518


Overview

Basic Information
Taxon OID3300028198 Open in IMG/M
Scaffold IDGa0257121_1263518 Open in IMG/M
Source Dataset NameMarine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)522
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007946Metagenome / Metatranscriptome342Y
F008525Metagenome / Metatranscriptome332Y

Sequences

Protein IDFamilyRBSSequence
Ga0257121_12635182F008525GGAMLTFKESFNEVLEAKLKLPKGEKVAKEITKLGKKKNVTAVITSKFNLYIDGVLLDKYKDQAAAEKAVKEFIKLMGA
Ga0257121_12635183F007946N/ALYKEIMTTKTLIDNIKQGDAQKSNNTFNSLMQDKILSALDTHKKEVASKMYGASIDVPEGEPTTDANV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.