NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257120_1002287

Scaffold Ga0257120_1002287


Overview

Basic Information
Taxon OID3300028284 Open in IMG/M
Scaffold IDGa0257120_1002287 Open in IMG/M
Source Dataset NameMarine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11635
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (10.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017048Metagenome / Metatranscriptome243Y

Sequences

Protein IDFamilyRBSSequence
Ga0257120_10022877F017048N/AMSQHYQPSKSSLRADTVVEFVNKSLLEFKMKEIPGMGPASIDKFKEHGIYTPAQILAKFLSYVDSPNAKAIDVCNGFYDWASPIMGKANTHNLTFAMANYCGEHGLFKYE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.