NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257126_1003337

Scaffold Ga0257126_1003337


Overview

Basic Information
Taxon OID3300028287 Open in IMG/M
Scaffold IDGa0257126_1003337 Open in IMG/M
Source Dataset NameMarine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10165
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)120
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005350Metagenome / Metatranscriptome403Y
F007687Metagenome / Metatranscriptome346Y
F022107Metagenome / Metatranscriptome216Y

Sequences

Protein IDFamilyRBSSequence
Ga0257126_10033371F022107AGGAGGMDDQEIERKIHIAGFVGAAFGFVSGAALMTLVGIIF
Ga0257126_100333713F007687GGAGMVKKTAKTRADRGKFDSKHTDHAKPINRKVAAAVEPFTFASAAASKVWGDTLVNCVPPAYAVRYRELRDDLEGAMAAEDAALCVELATSLIKALKMMNLKARQDGHEPPKVDGHICEWGGKIYCFLTSGDISAVRRANKNWTVYHLSDVCAVLNALTDDLVAPVVNEFPKAKITAVRMYDDEINFEPTGG
Ga0257126_10033373F005350GGAMSDLIDCPECDGEGQVEREVWVRQSATWHGDFESEVQDCDNCSGKGQIEPLEEDE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.