Scaffold Ga0210315_1051307

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0210315_1051307

Scaffold Ga0210315_1051307

Overview

Basic Information
Taxon OID	3300028329 Open in IMG/M
Scaffold ID	Ga0210315_1051307 Open in IMG/M
Source Dataset Name	Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	540
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location Name	USA: Washington
Coordinates	Lat. (^o)	46.184	Long. (^o)	-123.182	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051728	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210315_10513071	F051728	N/A	QRMPKTAVEKWKKYIIGLKNKDFFDNLRSAKLLNCLSRIPTRRTRDAAQRIIGGGSKIKGAMQSLINGLNNIPKKALKRWWKTCDDIKNKRLYDNARSAKLLHSLDRIQRRTLKDAKDRVAGSLFDSPVMKKVIRRLDGLIRRKPKEAFDHWRKYAIAVNNKMVLDGVKSRELKTKLDK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.