Basic Information | |
---|---|
Taxon OID | 3300028411 Open in IMG/M |
Scaffold ID | Ga0306911_112629 Open in IMG/M |
Source Dataset Name | Saline lake microbial communities from Deep Lake, Antarctica - Metagenome TFF #695 (v2) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 599 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Antarctica: Deep Lake | |||||||
Coordinates | Lat. (o) | -68.5602 | Long. (o) | 78.1968 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010069 | Metagenome | 308 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0306911_1126291 | F010069 | GAG | MVNGMADGELRKSGGEGTGVCPKHFVPWVLTPIMGKFGVMVKGGCHFFFSDQGPLSKGGDDVGGEYPCERFFDFFVRMFTCDEAYMF |
⦗Top⦘ |