NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0306870_1001931

Scaffold Ga0306870_1001931


Overview

Basic Information
Taxon OID3300028413 Open in IMG/M
Scaffold IDGa0306870_1001931 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #496 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4415
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Rauer Islands
CoordinatesLat. (o)-68.5558Long. (o)78.1913Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026203Metagenome198Y
F048560Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0306870_10019314F026203GAGVENNFLTALTGQRTHEDLFKKIGLPRILFDKSCLWRILFHKKSGVWHILFIKNPFLNHSGMHFMSSFLFCLPIH
Ga0306870_10019316F048560N/AMSKAYQDPPPQLRLSATSNCKQRVRVRVPNSQGLHRTTQFLMQEYLNLVDWKGVEVPSTERRCKASVRKFERSPTVLTEWIELKETFANFKAESGREISHDKGSEDMTSKVERKRKSDASPMEFCRRSLAGGNIWDALADLLKIMKLRGVGADDVKEVWEIVKHLFTNIVKPARSKRDSRKAKTHVDHLLFQLVDDMHSIWNADSLLDRA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.