Scaffold Ga0256834_1001926

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256834_1001926

Scaffold Ga0256834_1001926

Overview

Basic Information
Taxon OID	3300028417 Open in IMG/M
Scaffold ID	Ga0256834_1001926 Open in IMG/M
Source Dataset Name	Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - 4281-140
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13581
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (12.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location
Location Name	Pacific Ocean: East Pacific Rise
Coordinates	Lat. (^o)	9.8384	Long. (^o)	-104.2913	Alt. (m)		Depth (m)	2510
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096595	Metagenome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256834_10019269	F096595	N/A	MDSIIKLGQYVRHQRLQKGMTQLELSLKVFNKPNQEYIGRLERGTAAGITFATANKIMLALDSELDSELEFREF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.