Scaffold Ga0256834_1009692

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256834_1009692

Scaffold Ga0256834_1009692

Overview

Basic Information
Taxon OID	3300028417 Open in IMG/M
Scaffold ID	Ga0256834_1009692 Open in IMG/M
Source Dataset Name	Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - 4281-140
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4810
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (14.29%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location
Location Name	Pacific Ocean: East Pacific Rise
Coordinates	Lat. (^o)	9.8384	Long. (^o)	-104.2913	Alt. (m)		Depth (m)	2510
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079616	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256834_10096927	F079616	AGG	MVNTFEIGEIVVCVNARRNWYKLGGLKRDEMYTVIGFNPYDKGLILKEVKSPGSGCHAYAAERFRKVDYNFAENIIEELQPQEEFQIIKS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.