Scaffold Ga0255345_1226329

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0255345_1226329

Scaffold Ga0255345_1226329

Overview

Basic Information
Taxon OID	3300028568 Open in IMG/M
Scaffold ID	Ga0255345_1226329 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant20
Source Dataset Category	Metagenome
Source Dataset Use Policy	Restricted
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components
Scaffold Length (bps)	729
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location Name	Canada: Vancouver, British Columbia
Coordinates	Lat. (^o)	49.1150727	Long. (^o)	-123.147	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002045	Metagenome / Metatranscriptome	599	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255345_12263292	F002045	GAG	MDITVRMTFFCVYCRTRKKFDKYIKVNKIKNKYIIDIKKIIEEEEVNFKDDRTYLKILIFNKIQQAIERKKDIYYIPDFDNEFSIEKLLNLKKILGENDFNVLIFYNEFRKNQEIIEDVFSNLSKFSSSQIIRDY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.