NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247818_10088368

Scaffold Ga0247818_10088368


Overview

Basic Information
Taxon OID3300028589 Open in IMG/M
Scaffold IDGa0247818_10088368 Open in IMG/M
Source Dataset NameSoil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2000
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.673Long. (o)-77.032Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044807Metagenome / Metatranscriptome154Y
F081908Metagenome / Metatranscriptome114Y
F084448Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0247818_100883682F044807N/AVPAGLFLCVASATWGDAGFFSPFYRIAGVLDRAAYDISLEEAANGSRFWLEPQTVLPGVCVHLALAGLFGMLFFLVTRELPSTRPAVVVAAGVVWGLLVALLMVPVLGLAGREVGGGTLIADAPSQMGWSTYLLMHLVYGSSLGAVVALVRRG
Ga0247818_100883684F084448AGGAGGMSNFAAGLLPGWASFLIFLPFIMLGFGLWFICRAFTDRGDARQADPDTQSRVVALPDRSQRPLYRVHQQIQASARPPPKAEPDEPERGRGGRRPPRRHRSNTRLELHQ
Ga0247818_100883685F081908N/ADGLLGVLGHYGGLDETAIIWVPLVMVGGLWWILRGGDPKEDEESSQEETR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.