Scaffold Ga0247611_10612357

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247611_10612357

Scaffold Ga0247611_10612357

Overview

Basic Information
Taxon OID	3300028591 Open in IMG/M
Scaffold ID	Ga0247611_10612357 Open in IMG/M
Source Dataset Name	Sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1770 DNA GHGhigh gp2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1160
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location Name	New Zealand: Palmerston North, Manawatu-Wanganui
Coordinates	Lat. (^o)	-40.3794	Long. (^o)	175.6106	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046116	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247611_106123572	F046116	AGGA	MVVSWGLIAGLSLPEIHRMRPGAVMDLFLYRRQYDDVMHWITRG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.