NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265294_10223311

Scaffold Ga0265294_10223311


Overview

Basic Information
Taxon OID3300028602 Open in IMG/M
Scaffold IDGa0265294_10223311 Open in IMG/M
Source Dataset NameGroundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1328
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Waterloo, Ontario
CoordinatesLat. (o)43.442Long. (o)-80.577Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071990Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0265294_102233112F071990GGAGGMAAPTTRFRLIPNTTAAAALDTAAERLAAVSGESVVSTGAGNEADFGTVDISGGAANSGVLHILWDVTADGGNTLVETFKLWCSSIGFAQAGSVVKVQPVSGADQVTPSDTENYVANATTASYTWATMVESEPGAQNVFPSDEGSSMALSTTSDDVVMWAMYLAIAADETTGTYSGTTAGYELQFSFKYAYS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.