NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265293_10181339

Scaffold Ga0265293_10181339


Overview

Basic Information
Taxon OID3300028603 Open in IMG/M
Scaffold IDGa0265293_10181339 Open in IMG/M
Source Dataset NameLeachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1488
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Waterloo, Ontario
CoordinatesLat. (o)43.442Long. (o)-80.577Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003987Metagenome / Metatranscriptome458Y
F004383Metagenome / Metatranscriptome440Y
F031138Metagenome / Metatranscriptome183Y

Sequences

Protein IDFamilyRBSSequence
Ga0265293_101813391F003987GGAGGMIPALPCGTYADSGVPAGAFYVAAFEDGDTPHHVGEYRIETLVRALRALQACGYDDVEIGSVERDGKTHLLLIGLDGEARFGDWQLGCIAVLPVGVE
Ga0265293_101813392F004383GGTGGMIPPDNLLERAFMARIRADEYREALAALQREFDARPDVIDLKRRIERCEEERRQCIAQAKAAGISKQGSFLLKIRTRKQRTVIPERFFARFGAETFVRCCTIAIGKAEALLGKGAFDDCCEVEVKEIGVSVEYERPEGSE
Ga0265293_101813394F031138AGAAGGMTKRTNYVGPCATACKPGAGTDAQDGTFDYIIVAAAEHAAREAGLPGRADRMIACRSCGAPTTSSDGICPDCAEALRVERAAALDERCRVHRVRHVEDLPVSVLEEMQAERGRC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.