NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257139_1047377

Scaffold Ga0257139_1047377


Overview

Basic Information
Taxon OID3300028620 Open in IMG/M
Scaffold IDGa0257139_1047377 Open in IMG/M
Source Dataset NameMetatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_80m (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)726
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)49.68Long. (o)-124.009Alt. (m)Depth (m)80
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064398Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0257139_10473771F064398N/AVKTVTLKKLCVMALCTFLLTLAFSGVGNAAPEETPSVYYLEYGGLKIDIRAPDQAYPGENITVTVKTEAVVPQIYVKYINVDLYGVVNATTEVILDQISHLKNSSLSSHEVQYNIKIPDNISPGLTYGEVSCEWEALGASFEILSSGFVLAYVKNIALEQLQAEYDELNATHQSILQENTELKSGINEDADSTRNLMYVFIATTVVASITVFVLLMRKPKKVWV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.