NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307298_10041217

Scaffold Ga0307298_10041217


Overview

Basic Information
Taxon OID3300028717 Open in IMG/M
Scaffold IDGa0307298_10041217 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1251
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000805Metagenome / Metatranscriptome883Y
F012223Metagenome / Metatranscriptome282Y
F021376Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0307298_100412171F021376N/AVYLKHVTSLQFLTYVSFFAVLLAAMFRFVPGRTPPTRDEPYSDEELHAHDRKTAKYFLAGGCFLVLGSL
Ga0307298_100412174F000805AGGAGMGMPSGDSPAKAQAYYHYLNAHQLSMQRPATWEVRWLDLAWLWGFAIALSVITLLWIWQYRSTRQKSNLYPVDSFGGYTTELAGPATAFFLILTVLLTGFAVVLIVGHLVWGQKF
Ga0307298_100412175F012223N/AMDTFFIFSGLAVLAFVAAWKAGHFQDLDQLGSLPLYVEEEDYYTPEWALDEEEWLDGDA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.