NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302301_1000124

Scaffold Ga0302301_1000124


Overview

Basic Information
Taxon OID3300028731 Open in IMG/M
Scaffold IDGa0302301_1000124 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)63902
Total Scaffold Genes77 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)58 (75.32%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3535Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002248Metagenome / Metatranscriptome578Y
F005538Metagenome / Metatranscriptome397Y
F032939Metagenome / Metatranscriptome178Y

Sequences

Protein IDFamilyRBSSequence
Ga0302301_10001241F032939AGGMTIEIRDASLQARIRRQLQATGFSSVEEVLLRLLAATPALSS
Ga0302301_100012410F005538AGGGGGMDFQVNDETYFVSLAEDERRWRVFVSTATGAWPIPVYEDAAESGPLVMLQEERHRIPN
Ga0302301_100012436F002248AGGAGMDRRRQSRVFVDLPVQIWGMDTYSRPFIQPASLRTISGRGATLQCVDARLKPGDVIDVLYEGTKAQFRIVWCGKPGTEMAGEVGVENLSTDVALWDVDPVRCAAAAGQG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.