NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302224_10102175

Scaffold Ga0302224_10102175


Overview

Basic Information
Taxon OID3300028759 Open in IMG/M
Scaffold IDGa0302224_10102175 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1104
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3535Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005157Metagenome / Metatranscriptome410Y
F016252Metagenome / Metatranscriptome248Y

Sequences

Protein IDFamilyRBSSequence
Ga0302224_101021751F005157GGAMRLKSVLEDFEANTLRVVPGLLGRLFYVGRLHDGHGGYDHWGLAKVYGGEAAQRAIRASHRLLLSEVLKKPLSVLLNDVPACCSREGLTEREFLALLSQASPKPLSPAARAHLDSVLNALSALIESRNI
Ga0302224_101021752F016252N/AMLSMNWHKLLALFLWISPHALLGVLAVVLCKRRLYREFPAFSAYVFYEIAEFILLFTLYFVQGTGGKQYRYAFCATLLLSIALRFGVIDEVAKGLFRKSQFLKVAARRWLLCIQGLLLMMAVLLAVSAPGGNSLGLAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.