NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307290_10361540

Scaffold Ga0307290_10361540


Overview

Basic Information
Taxon OID3300028791 Open in IMG/M
Scaffold IDGa0307290_10361540 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)531
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040873Metagenome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0307290_103615402F040873N/AFQISISNRSSLEGTDLVAVFIDADGKTGTGCARGVFGAEYALDVLAGRYVFGRCLSGRWSFSNRPTSFSGSFASSTLTLKVNRRDLGGTSRLDFRIGAAATTEADPAYDFAPDIGATAWSYQVIAPPQAVLKPPARVRKACRQHPRRCKLNRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.