NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265338_10058364

Scaffold Ga0265338_10058364


Overview

Basic Information
Taxon OID3300028800 Open in IMG/M
Scaffold IDGa0265338_10058364 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3406
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Carex Aquatilis Grown In University Of Washington, Seatle, Wa, United States

Source Dataset Sampling Location
Location NameUSA: Seattle, Washington
CoordinatesLat. (o)47.6516Long. (o)-122.3045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003832Metagenome / Metatranscriptome466Y
F005268Metagenome / Metatranscriptome406Y
F014888Metagenome / Metatranscriptome259Y
F040210Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0265338_100583642F040210AGGAGMKRSLKALLLLIGLVGTFAYAAVPQVPTPGGPIAICPPSRPKCDA
Ga0265338_100583644F005268GAGGVTLSPEETEQQQAWRELSEAGLVEIRLDQFAERIKDVKSLVILRLRELLDFNTGVKERESAAYSLGTLKRLEMKVLANASESELTEK
Ga0265338_100583645F003832GGAMPSTLQQLRRSSVWPPERGEMVSFASAAGPESAVLREVRWGLVWRDFVLVDGRVIPEHRVVGCPQPHEWRKASEVSDKEREDCEERLLSMAGSGMDPRKRDQSFWAELNQYLAYTYLRFKQAP
Ga0265338_100583647F014888AGGAGMNKVLELLLTGLALAALYSAIPTTASHTSNSAFRAEQAVVVADGTDPMPLCRARRCTQTQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.