NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307503_10000002

Scaffold Ga0307503_10000002


Overview

Basic Information
Taxon OID3300028802 Open in IMG/M
Scaffold IDGa0307503_10000002 Open in IMG/M
Source Dataset NameSoil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)447466
Total Scaffold Genes442 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)307 (69.46%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)46.6992Long. (o)-120.899Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005789Metagenome / Metatranscriptome390Y
F009274Metagenome / Metatranscriptome320Y
F032367Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0307503_10000002171F009274GAGGMLPAWIARRAAPAIWRRIPWKMVWTISLWLAEKGRERIKDNLDDREQSEFWNLVKKSRGRPSNLAQRDRTRMKNIVGKAIRGS
Ga0307503_10000002438F032367N/AMTRKRDIKQFRQACREVGLTVQERYEASQALHVEKESAGVQAHMSYGELLTWLRQWRQR
Ga0307503_10000002439F005789GGAGGMATVVALDSSPANVLRSMRGSIVDARTAYPDVLHVEVRDSVGELWRLATQDAEWSPTDPAELVGKSIEDAEIDEETGELRCQLSGGSLLDVKPAAQEADDDPPNWELITPGGVLLEFGPGVRWQISSATDPVSARR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.