Basic Information | |
---|---|
Taxon OID | 3300028805 Open in IMG/M |
Scaffold ID | Ga0247608_11227794 Open in IMG/M |
Source Dataset Name | Sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1766 DNA GHGlow gp2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 674 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | New Zealand: Palmerston North, Manawatu-Wanganui | |||||||
Coordinates | Lat. (o) | -40.3794 | Long. (o) | 175.6106 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F052998 | Metagenome / Metatranscriptome | 141 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247608_112277941 | F052998 | N/A | LEKQIKNLTDTNTNFLQENNDVQAKLKEYQLYTNKAKLNKDDLDEKKFSILEGMSQRAEAAELEVQKLKSFIEELKALNEKLRNKIKPLEDYALLQIKYDHEINTGIDTLYDLKNKIFTDEERNEIDILKKDPSKLLLSLIKLKTENLELHNQLKDITIECNQQLRQAK |
⦗Top⦘ |