NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307302_10018311

Scaffold Ga0307302_10018311


Overview

Basic Information
Taxon OID3300028814 Open in IMG/M
Scaffold IDGa0307302_10018311 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3163
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001757Metagenome / Metatranscriptome641N
F003760Metagenome / Metatranscriptome470Y
F075885Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0307302_100183115F001757AGGAMMRVLKRLQDKATTGAGKRLVLPEPRRVRFLIRGEGPVSAGAVTIECCPESTKAGKFWMELATIPVPADNGLAQYYTEEASGLFRARISRPVSNGTVTVTPLVSRGRPDRPDSTKVI
Ga0307302_100183116F075885GAGMQQPADVVVRPAIKHVPRSVARDAHERIVRCGLGIVPVRSETEDKFEDAMEVTASSPLFELSRVLVRFNHVARFIVNANHGIM
Ga0307302_100183117F003760AGGAGGMKPKQIFISILAVLFVFPLMETFAQRAANSGSIEVITTFDYPGTGN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.