NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307310_10496821

Scaffold Ga0307310_10496821


Overview

Basic Information
Taxon OID3300028824 Open in IMG/M
Scaffold IDGa0307310_10496821 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)614
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000283Metagenome / Metatranscriptome1379Y
F005544Metagenome / Metatranscriptome397Y

Sequences

Protein IDFamilyRBSSequence
Ga0307310_104968211F000283N/AAIFIASCGTATFTKTGSDATIESLRNFHLAFIDEFAVPGKKFNATAFNAKVSEGNAKFQQAIAEEKFTARRPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR
Ga0307310_104968212F005544N/AMPSGGKKKHKKPSGKKSELDSALDQIGDESAAAATKEFQDLLGQAKGDTSELVRQNAEEVEQRLVLLKKRKIDKEDFDYFIENQNDTATT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.