NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265298_10010024

Scaffold Ga0265298_10010024


Overview

Basic Information
Taxon OID3300028832 Open in IMG/M
Scaffold IDGa0265298_10010024 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_01
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11240
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)30 (96.77%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameAustralia: Woodstock, Queensland
CoordinatesLat. (o)-19.6574Long. (o)146.8351Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065312Metagenome / Metatranscriptome127Y
F086398Metagenome / Metatranscriptome110Y
F087968Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0265298_1001002420F087968AGAAGGMVKITRALAKKMYDSGEEIMVIPNRVRPNGILAGWTSKPADDPTADFDKLCNAVFYYNCSPETGMKLAFYAKEV
Ga0265298_1001002422F086398AGGAGGMKEQMTYHVAVQRAERVKHIIDDIGIGQIVKEKYTRFSLEQAGRWVCLTDTGITIIKDEAKEKIITMYVTTQRELVAVFGGANKVPTFLRKKVDHNQSKYTERGKTIWK
Ga0265298_1001002425F065312AGGAMAMSQKRKQKPKTWVEVFQSERKTFPQGYCVTRIREDKRKKQPKHKLKEWE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.