NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265298_10965568

Scaffold Ga0265298_10965568


Overview

Basic Information
Taxon OID3300028832 Open in IMG/M
Scaffold IDGa0265298_10965568 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_01
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)741
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameAustralia: Woodstock, Queensland
CoordinatesLat. (o)-19.6574Long. (o)146.8351Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037527Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0265298_109655681F037527N/AEMSCFFKNYRKILIKQNDMVKNHMKDFFKYINLEGKAYNELIERREELKAKYTTENQKLTAKKEKLYATGDITKFELGDEKNVDRDRVLHDKPYAFEHMCKTDSNNLLKIYNQLGYANKMNMRELKKMIKEYCVRYVENVKKFDEEFYPSINDLVGTWSNMETFVMSANMPKQPGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.