NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256407_10000247

Scaffold Ga0256407_10000247


Overview

Basic Information
Taxon OID3300028886 Open in IMG/M
Scaffold IDGa0256407_10000247 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from Lethbridge, Alberta, Canada - RJG_04
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)135815
Total Scaffold Genes215 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (13.49%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales(Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameCanada: Alberta
CoordinatesLat. (o)49.6935Long. (o)-112.8418Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072887Metagenome / Metatranscriptome121Y
F082004Metagenome / Metatranscriptome113Y
F082826Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0256407_10000247165F082826AGGMGRFTIEMNYNASIIVEVNAEDEGKALDEARNIAEDADIREFTITSERESRILKRE
Ga0256407_1000024758F082004N/AMIIHLNLTEDHLKLVRFLNIEDVDDDFLKINKKEMLTMRTHILDDIAMILGLRDKAIDGTDGDADGRAYDDESEKYMLDTYHYVSDNLYYIETLLHQMVMEGVKPGEYIAKDNELIWSLKEN
Ga0256407_1000024784F072887N/AMEKCMRCEHDLILTSNFMLSEVSGVDLDEDDDAIVTYAECPYCGAKYELTDTPESEKKNYPYWNGNHSIVYE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.