NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308309_10000126

Scaffold Ga0308309_10000126


Overview

Basic Information
Taxon OID3300028906 Open in IMG/M
Scaffold IDGa0308309_10000126 Open in IMG/M
Source Dataset NameWarmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)64786
Total Scaffold Genes59 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)36 (61.02%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Associated Families5

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location
Location NameUSA: New Hampshire, Hubbard Brook experimental Forest
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000522Metagenome / Metatranscriptome1055Y
F001701Metagenome / Metatranscriptome649Y
F006766Metagenome / Metatranscriptome365Y
F007287Metagenome / Metatranscriptome354Y
F007926Metagenome / Metatranscriptome342Y

Sequences

Protein IDFamilyRBSSequence
Ga0308309_1000012618F001701N/AMNSIKFLYAAYIATWLIHALYLGSLVRRYSRLRQQMKGLGKSGK
Ga0308309_1000012628F000522GAGGMDHHEAVRKFEHLMLKEADHAREVATELEALVPILTTENSRQLAQVQIKASHKQAKEFRELAEKVKEK
Ga0308309_1000012631F007287GGAGGMPGRSPIRSTILYKTIFICLLLAPFCAASDHWDYEESHSDVRDFVAGGMVHVRLSVGDLRVTRGNSNQIRLHYTVKSRRESHVRDAHVEFEIHGRDAELEFHAPTTGGNTQFDVELEVPRNTNLDVHEKVGDLTVEDIEGDKDLELGVGDIRVAFGRSAYHLVRASTSIGDVNGGDGYDESGGWLGKTLKYHGDGRYELQAHVGVGDITLEGK
Ga0308309_1000012642F007926N/AMVLREDPPTAERAFGRRLLVACISLLLSPLAADARGVPSVDPGYVSALAAADHFLQAWQSGDVESGMVLLSSHAKEAATTEVVEAFFTDPGRSAYEIGRGKLLKRGRYEFPVVLVGAAKNAHTRRRFSSIVVVNTGNNDWAVDKLP
Ga0308309_1000012658F006766GAGGMYTGTLIKDLMAIVEQAERGTQQKRIADEMELRRLFELQIPQMQSEQVLVGAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.