Scaffold Ga0168030_100109

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0168030_100109

Scaffold Ga0168030_100109

Overview

Basic Information
Taxon OID	3300029179 Open in IMG/M
Scaffold ID	Ga0168030_100109 Open in IMG/M
Source Dataset Name	Aquariaum water viral communities from Chicago, USA - Amazon Rising - AZ2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Michigan State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11767
Total Scaffold Genes	32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (9.38%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water → Aquariaum Water Viral Communities From Chicago, Usa

Source Dataset Sampling Location
Location Name	USA: Chicago
Coordinates	Lat. (^o)	41.87	Long. (^o)	-87.61	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042224	Metagenome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168030_10010931	F042224	N/A	MTKLLIIYRLFDSNYGKQGNPKTLSVYLREDKTLGYSYYGGWQDSGMGYAIGNMQLKKSLPMGSRNFKTTKKLHNEIVSVLKTGVGSHEISSFEILNEL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.