 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300029248 Open in IMG/M |
| Scaffold ID | Ga0168696_1000383 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011688-36 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 42748 |
| Total Scaffold Genes | 33 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 30 (90.91%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Beijing, Peking Union Medical College | |||||||
| Coordinates | Lat. (o) | 39.911947 | Long. (o) | 116.4156125 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088921 | Metagenome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0168696_100038330 | F088921 | N/A | LGATIRLYKIWAGKNNFLCSEKSKSTVFDLDRETKKRKYAKETCRIYIEKDQNMQEEKKEKYINGEIYGEKNQIIVANKSAMIRYKMRSK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |