NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0168097_1009069

Scaffold Ga0168097_1009069


Overview

Basic Information
Taxon OID3300029255 Open in IMG/M
Scaffold IDGa0168097_1009069 Open in IMG/M
Source Dataset NameBiosolids microbial communities from sewage treatment plant in Sweden - SWESTP9 - Uppsala-digested 110
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Gothenburg
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3195
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin016(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location NameSweden
CoordinatesLat. (o)59.844519Long. (o)17.659844Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049017Metagenome / Metatranscriptome147N
F050405Metagenome / Metatranscriptome145N

Sequences

Protein IDFamilyRBSSequence
Ga0168097_10090692F049017N/AMAIAKYSKTCGKNVPGNSRLFFVEAANISSITVTSNEISAVTMANTTKFREFGADIDSIKFTIEGTGSASYSEVQKLEAKFSKKTTALITAKNSLLDAVACGVAIIRVDNNANAWLSGYTFKDKNRRAYNKITTNFDTGAKPSDEGTAAYTITLEAEGFDDELPFDTTLNAAIVGGTATFIDYN
Ga0168097_10090694F050405N/AMIIEQEVITICKANYDANLITQGALLVGMRKVKEIIGSDLYKKVEQIGYEELLEKCKVLAAWSVHALMVDRIATEMTNKGVYQLYTVGSNGVQLTELTQIKAAINEITTACANEIKDFIQERVAAHDPLYVNYVTELKTTSKPSLVSNIKRVTQI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.