NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134541_1001654

Scaffold Ga0134541_1001654


Overview

Basic Information
Taxon OID3300029297 Open in IMG/M
Scaffold IDGa0134541_1001654 Open in IMG/M
Source Dataset NameMouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - LGG W0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hong Kong
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11132
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Gut → Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg

Source Dataset Sampling Location
Location NameHong Kong
CoordinatesLat. (o)22.3356Long. (o)114.1826Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099451Metagenome103N

Sequences

Protein IDFamilyRBSSequence
Ga0134541_100165423F099451N/AMSEIKTVGDLRKVIANLDDSFKIEMRIRRKLTDEELKYMPYPYPYETEYSTLEFDDIGYSDKELCLGVERGQNNE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.