Scaffold Ga0135227_1003462

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0135227_1003462

Scaffold Ga0135227_1003462

Overview

Basic Information
Taxon OID	3300029302 Open in IMG/M
Scaffold ID	Ga0135227_1003462 Open in IMG/M
Source Dataset Name	Marine harbor viral communities from the Indian Ocean - SRB3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Michigan State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	942
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean

Source Dataset Sampling Location
Location Name	Indian Ocean
Coordinates	Lat. (^o)	3.715	Long. (^o)	105.408333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008925	Metagenome	326	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0135227_10034624	F008925	AGGA	MTTKTKPKINAVTLNLINKLKAIDDTINEGAWEYIHLGDIIRLQDAFQEAINYYDLKKKGGIGEYGADEGKYVQFYHSDYVCHTDPEAFDPSKVEEEEDES

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.