Scaffold Ga0119857_1000440

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119857_1000440

Scaffold Ga0119857_1000440

Overview

Basic Information
Taxon OID	3300029304 Open in IMG/M
Scaffold ID	Ga0119857_1000440 Open in IMG/M
Source Dataset Name	Anaerobic bioreactor microbial community of Freshwater lake and wastewater samples from Australia - AOM-metagenome-Illumina
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Queensland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	21891
Total Scaffold Genes	19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (63.16%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Anaerobic Bioreactor → Anaerobic Bioreactor Microbial Community Of Freshwater Lake And Wastewater Samples From Australia

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076231	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119857_10004405	F076231	GGAG	MIQLKPNKNGTADVNEFSGFVSTKHNGVTNLTKIVLAISVLLAVLMFVSK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.