NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0183683_1000407

Scaffold Ga0183683_1000407


Overview

Basic Information
Taxon OID3300029309 Open in IMG/M
Scaffold IDGa0183683_1000407 Open in IMG/M
Source Dataset NameMarine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)24159
Total Scaffold Genes37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (67.57%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameSouth Pacific Ocean: TARA_100
CoordinatesLat. (o)-13.0023Long. (o)-95.9759Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003361Metagenome / Metatranscriptome492Y
F055730Metagenome138N

Sequences

Protein IDFamilyRBSSequence
Ga0183683_100040726F003361AGGMKLTLNGALDLSRSINNQSIWNKRSLEFVNGLAKDFKQESIDRLHLPPSPRSQKGRGNKNTGNLRRSIYTKKLGNTNRLRMSEGFSLATNQRYAPFVHGKPIFRSFTPVKRTKPFFPPYKEGSGLHKWANRGNPKMNPFLVAKKISQRGLKMKPFIGGVVFENQKEIKKRGDKMLELIANDIVRSVR
Ga0183683_100040733F055730N/AMAVNFDSNVSITVEIAFDSNPLDSSQSFTDVSSFLRSFETTRGRVSNLTDFQTGTAIVELDNRDNRFSPNQTTHYYDSVNNRSKVQPLKRLRIKATYDSTTYTIFHGFVESFPVNYAGQGSDSTTKIRVVDAFKLFFNSTLNGIGWRLGISLLGESTNLTLTQAQELSSVRVKNILDSFGYSDQQISTGQLEVQVQDTTDDLLTALRKVELAENGTFFIAADGKATFRDRNFRLTNTTTPAATFGQGVGELPYVDIISSFDDNKIINTVQRTRTGGTTQIAIDSGSLQRFGSHVLTESGTLNVSDDNTASIAAQKVRANAIPQTTIESLSFTPQQNTSLWPKALGLDIGTFVEAKVTTPSTTIETYDLFIERIRHNVDASTSTWNWTIGLSPAETGAWILGVNRLGIDTNLSYT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.