Scaffold Ga0183748_1000563

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0183748_1000563

Scaffold Ga0183748_1000563

Overview

Basic Information
Taxon OID	3300029319 Open in IMG/M
Scaffold ID	Ga0183748_1000563 Open in IMG/M
Source Dataset Name	Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	25304
Total Scaffold Genes	40 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	17 (42.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	Red Sea: TARA_032
Coordinates	Lat. (^o)	23.36	Long. (^o)	37.2183	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062838	Metagenome	130	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0183748_10005632	F062838	GGA	MRDTTVIIYCHRDRKDAPLASVRYTKYDALGRVIDVDQVDYEDKTYFHSEVLQAVTCGVDVLIYTGMDGMSLQRKIEKWT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.