NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0183748_1001025

Scaffold Ga0183748_1001025


Overview

Basic Information
Taxon OID3300029319 Open in IMG/M
Scaffold IDGa0183748_1001025 Open in IMG/M
Source Dataset NameMarine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17443
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (16.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameRed Sea: TARA_032
CoordinatesLat. (o)23.36Long. (o)37.2183Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024093Metagenome / Metatranscriptome207Y
F035957Metagenome / Metatranscriptome171Y

Sequences

Protein IDFamilyRBSSequence
Ga0183748_100102521F035957N/AMSKQRYFDDLTLEEMFKHHDHTYMMSDDSRYYEAGRRERDIIHDKVKAEGGWTREMVDLYNKYAPEGMFQMDYDFLTNKAE
Ga0183748_100102525F024093N/AMAVIKQIHIVAKEIADDIVKDIYKQCDWQVGQFLPDNSEGNTINEAHSYMMRTVARHIANKLNVTTNKYYDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.