NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0242844_100531

Scaffold Ga0242844_100531


Overview

Basic Information
Taxon OID3300029325 Open in IMG/M
Scaffold IDGa0242844_100531 Open in IMG/M
Source Dataset NameHuman feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 016_6_7_stool_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)43611
Total Scaffold Genes93 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)50 (53.76%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa

Source Dataset Sampling Location
Location NameUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057001Metagenome137Y
F080673Metagenome115N

Sequences

Protein IDFamilyRBSSequence
Ga0242844_10053187F080673GGAMKLQDEALLYLRDNITREEAYYILTTENEMTEVLIAKKEDGGKRIKILDMEYTIEKDDMLFLFDTDGVIDECLLVASYIGVNMYFRRQDVNAILNNINREKVLKYPYIAIQLDNIQTVEKRRVVFEITGHRMDDNKERIDFMFVYFMARLCV
Ga0242844_10053193F057001N/AMTSKDLNKVQNEVKKASEKTLAGAVKAWCQLFKSGKEVNEILKDNDIKVDKAIVPALVALAKEKEMVIQLCKEILPRVNDTFCAYKEVEREYYDKQDQANNSKLPLDKINNIAVFGNTHKRFGYCEPVAYSDTDSAPYYEVFNGSDKRIVKVAIPIKRYTYNLIAKCITYYLTHPKNDR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.