Scaffold Ga0243509_100199

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0243509_100199

Scaffold Ga0243509_100199

Overview

Basic Information
Taxon OID	3300029327 Open in IMG/M
Scaffold ID	Ga0243509_100199 Open in IMG/M
Source Dataset Name	Anode biofilm microbial communities from glucose-fed MFC - GM-anode biofilm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Tokyo University of Pharmacy and Life Sciences
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	60921
Total Scaffold Genes	47 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	30 (63.83%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Industrial Production → Engineered Product → Bioanode → Unclassified → Anode Biofilm → Electrode-Associated Soil And Biofilms Microbial Communities From Mfcs In Japan

Source Dataset Sampling Location
Location Name	Japan: Tokyo
Coordinates	Lat. (^o)	35.638	Long. (^o)	139.3817	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057843	Metagenome / Metatranscriptome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0243509_10019918	F057843	AGG	VGFIYKNHLLRSKSVQLSERDRWTLEVTVVRNYGSEGATEQTFSSEKTFHSKEIADMEGIMFARKIIDGEINGLSIEDR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.