NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0242807_102395

Scaffold Ga0242807_102395


Overview

Basic Information
Taxon OID3300029329 Open in IMG/M
Scaffold IDGa0242807_102395 Open in IMG/M
Source Dataset NameHuman feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 009_6_30_stool_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14998
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (22.73%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides xylanisolvens(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa

Source Dataset Sampling Location
Location NameUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051936Metagenome143N

Sequences

Protein IDFamilyRBSSequence
Ga0242807_10239512F051936N/AMKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVTSIFFSRLIIRYLSIHISIKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.