NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0243725_1000766

Scaffold Ga0243725_1000766


Overview

Basic Information
Taxon OID3300029343 Open in IMG/M
Scaffold IDGa0243725_1000766 Open in IMG/M
Source Dataset NameHuman feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 025_10_26_stool_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)36824
Total Scaffold Genes36 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)31 (86.11%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Source Dataset Sampling Location
Location NameUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097172Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0243725_10007662F097172AGGAGGMKKNVLKKLMCAVLATACVATAVVPAMADDVVTAEAATKKVTSAYRYHIDGYNKKGYPASYSKASFYKDLNSLPAVKTGKTTINVPAVTSSVKSVSKEKDNPEYESFVKFKAPKTGKYVFTLNNLQGTDDKSLKCFSGGIYKPVKNGKKYTLEDLYPDEVGDYTTLYENNYLARLRTILDNYKEEHPEYADVIEETYSDETDFVNHRPVNKIKFTTRLKKGQIYVFVIDNRGMAKAVPPYFTTHGSDEQSCLWGGNYLKAYSFDMNIEYRK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.