NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0238435_108104

Scaffold Ga0238435_108104


Overview

Basic Information
Taxon OID3300029349 Open in IMG/M
Scaffold IDGa0238435_108104 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1022
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Klamath Basin, Usa

Source Dataset Sampling Location
Location NameUSA: Iron Gate Dam, Klamath Basin, California
CoordinatesLat. (o)41.93Long. (o)-122.44Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001092Metagenome / Metatranscriptome780Y

Sequences

Protein IDFamilyRBSSequence
Ga0238435_1081041F001092N/AAAKSAGSIVKSLKKAGFYEASKPKRLGIINKVTTKPQRIEMVDKMFLAKKAKGKTK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.