Basic Information | |
---|---|
Taxon OID | 3300029446 Open in IMG/M |
Scaffold ID | Ga0167332_1030955 Open in IMG/M |
Source Dataset Name | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP13 - Kappala-digested 114 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Gothenburg |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1284 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leucobacter → unclassified Leucobacter → Leucobacter sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden | |||||||
Coordinates | Lat. (o) | 59.355554 | Long. (o) | 18.227079 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067770 | Metagenome / Metatranscriptome | 125 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0167332_10309552 | F067770 | GAG | MIEFKYNSPIFKLGKISRSEWRELGMSARSEIVKRTRSGIDINHQPFHEYSAMTQEYKSGIMQTRGLGSSVVTLQDTGQMHRSLSIEIQANAAILYYADQNRARVALLHQTGGYHLPKREHFGFNKTDGNKYLEKIAKLQTIKNKKANR |
⦗Top⦘ |