NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0243128_1100743

Scaffold Ga0243128_1100743


Overview

Basic Information
Taxon OID3300029449 Open in IMG/M
Scaffold IDGa0243128_1100743 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellow Sea, Weihai, China - HGD.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShandong University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)761
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Sediment → Sediment Microbial Communities From Yellow Sea, Weihai, China

Source Dataset Sampling Location
Location NameChina: Weihai
CoordinatesLat. (o)37.31Long. (o)122.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079672Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0243128_11007431F079672N/AIIRERYENGILVERTVEGSNTTPWHWLTLVVHTVIAISLVALVAISIHDSLALRAIQSEEDA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.