Scaffold Ga0244069_103195

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0244069_103195

Scaffold Ga0244069_103195

Overview

Basic Information
Taxon OID	3300029451 Open in IMG/M
Scaffold ID	Ga0244069_103195 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001823-33
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1849
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China

Source Dataset Sampling Location
Location Name	China: Shanghai
Coordinates	Lat. (^o)	31.2123446	Long. (^o)	121.4684853	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080163	Metagenome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0244069_1031952	F080163	N/A	MKTIKFLQESFETKEKFQQEISFKYSYNLDTVESIDFRINRCNIRYFYEAMQNFENSLVDEFKEKKTNFCNANQFLESINDFDKILFVIITYMKTYFDFCKDYSKISFHVHLVQFDFTISVLIQGFYNYSHSDLSFSTKLESEVLDSEIELLQEKLDLIREEICELIGVDPNLEKQGHEDNYIFNLNIDSDNQIGFFLQATEL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.