NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0244916_104926

Scaffold Ga0244916_104926


Overview

Basic Information
Taxon OID3300029570 Open in IMG/M
Scaffold IDGa0244916_104926 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from Shanghai, China - P031V6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5514
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → unclassified Roseburia → Roseburia sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China

Source Dataset Sampling Location
Location NameChina: Shanghai
CoordinatesLat. (o)31.2112312Long. (o)121.4647709Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097172Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0244916_1049262F097172N/AVQXXXXLAAACVATAVVPAMADDVVTAEATTKKVTSAYRYHLIGYDKKGYVMDGFSKASFYKDLNSLPTVKTGKTTINVPAVTSSVKSVSKEKGEPRYKSFVKFKAPKTGKYVFSLDNLQGTDDKSLKCFSGSIRKPVKNEKKYTLEDLYPDEVGDYTTLYENNYLARLRTILDNYKAEHPEYADVIEETYIDYTEYVSKHPVDKDKFTTRLKKGQTYVFVIDNIGMQKAVPPYFTTHGSDEQSCLWGGNYLKAYSFDMNIEYKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.