Scaffold Ga0311297_1417232

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0311297_1417232

Scaffold Ga0311297_1417232

Overview

Basic Information
Taxon OID	3300029625 Open in IMG/M
Scaffold ID	Ga0311297_1417232 Open in IMG/M
Source Dataset Name	Mildly acidic thermal spring sediment microbial community from Yellowstone National Park, USA - SJ3 Spring
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Wisconsin, Madison
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	969
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Thermal Spring Sediment Microbial Community From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location Name	Smokejumper Geyser Basin, Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.41595	Long. (^o)	-110.95576667	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094112	Metagenome / Metatranscriptome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0311297_14172322	F094112	GAGG	MSNVAVYKRGYNFMTLANGLGTKISLNFGLTTYNYPILAIFVYLYNTSSPASGYIKATITPLDEVATGYVGYSPTISYFIDPHKGAMYIPLAPHEYINITITPSAGANLAYDAFLYDWMGEN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.